PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.RMG12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family HD-ZIP
Protein Properties Length: 204aa    MW: 23017.3 Da    PI: 9.3157
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.RMG12genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.71.1e-1965119256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
     Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                  rk+ ++tkeq + Lee F++n++++ +++e LA++l+L  rqV vWFqNrRa+ k
  Aradu.RMG12  65 RKKLRLTKEQSRLLEESFRQNHTLNPKQKESLAMQLNLRARQVEVWFQNRRARSK 119
                  78889************************************************98 PP

2HD-ZIP_I/II115.62.9e-3765153189
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                  +kk+rl+keq++lLEesF+++++L+p++K++la +L+l++rqv+vWFqnrRAR k+kq+E+++e+Lkr++ +l+e+++rL+keveeLr+
  Aradu.RMG12  65 RKKLRLTKEQSRLLEESFRQNHTLNPKQKESLAMQLNLRARQVEVWFQNRRARSKLKQTEMECEYLKRWFGSLTEQKRRLQKEVEELRA 153
                  69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.9E-1950119IPR009057Homeodomain-like
SuperFamilySSF466891.63E-1950122IPR009057Homeodomain-like
PROSITE profilePS5007117.7561121IPR001356Homeobox domain
SMARTSM003898.5E-1863125IPR001356Homeobox domain
CDDcd000867.55E-1664122No hitNo description
PfamPF000464.5E-1765119IPR001356Homeobox domain
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
SMARTSM003402.3E-20121164IPR003106Leucine zipper, homeobox-associated
PfamPF021834.8E-10121155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAVLPGSSSS LELTISVPGF ASSPPLLPSS SVKELDINQL PSEEEWIIAS NMEDEEESSN  60
GEPPRKKLRL TKEQSRLLEE SFRQNHTLNP KQKESLAMQL NLRARQVEVW FQNRRARSKL  120
KQTEMECEYL KRWFGSLTEQ KRRLQKEVEE LRAMKVGPPT VLSPHTSQPL PASSLTMCPR  180
CQRVTSTATL LSSPKSHQPP AASP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARSKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015960299.11e-145PREDICTED: homeobox-leucine zipper protein HOX3-like
SwissprotQ0JKX18e-82HOX3_ORYSJ; Homeobox-leucine zipper protein HOX3
SwissprotQ9XH388e-82HOX3_ORYSI; Homeobox-leucine zipper protein HOX3
TrEMBLI1ND771e-116I1ND77_SOYBN; Uncharacterized protein
STRINGGLYMA20G01770.11e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95063040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01430.14e-78homeobox-leucine zipper protein 17